<?xml version="1.0" encoding="utf-8"?>
<!DOCTYPE document PUBLIC "-//CNX//DTD CNXML 0.5 plus MathML//EN" "http://cnx.rice.edu/cnxml/0.5/DTD/cnxml_mathml.dtd">
<document xmlns="http://cnx.rice.edu/cnxml" xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="new0">
	<name xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">Multiple Sequence Alignment</name>
	<metadata xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">
  <md:version xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">2.11</md:version>
  <md:created xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">2003/01/30</md:created>
  <md:revised xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">2007/09/12 12:08:35.151 GMT-5</md:revised>
  <md:authorlist xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">
      <md:author xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="mscates">
      <md:firstname xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">Susan</md:firstname>
      
      <md:surname xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">Cates</md:surname>
      <md:email xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">mscates@bioc.rice.edu</md:email>
    </md:author>
  </md:authorlist>

  <md:maintainerlist xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">
    <md:maintainer xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="mscates">
      <md:firstname xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">Susan</md:firstname>
      
      <md:surname xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">Cates</md:surname>
      <md:email xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">mscates@bioc.rice.edu</md:email>
    </md:maintainer>
  </md:maintainerlist>
  
  <md:keywordlist xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">
    <md:keyword xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">bioinformatics</md:keyword>
    <md:keyword xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">clustalw</md:keyword>
    <md:keyword xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">multiple sequence alignment</md:keyword>
    <md:keyword xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">protein sequence</md:keyword>
    <md:keyword xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">sequence comparison</md:keyword>
  </md:keywordlist>

  <md:abstract xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">This module introduces the reader to multiple sequence alignments.  The ClustalW alignment tool is used to align sequences of troponin I from different human tissues and sequences of the cystic fibrosis transmembrane receptor (CFTR) from several different species.</md:abstract>
</metadata>
	<content xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">
		<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="intro">
Sequence alignments can be used to study the relationship(s) between sequences in sets of more than two sequences.  This application is particularly useful when studying the relationships between a similar type of gene product that is expressed by different organisms, like analyzing CFTR sequences from several different species, or when studying similar, yet divergent, sequences within the same organism, as the variance in troponin I isoforms in Homo sapiens.
    </para>
		<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="para1">
Often, a primary focus of a multiple sequence alignment is to identify, within 
several related sequences, regions that are highly conserved in identity or 
similarity, and therefore probably have functional and/or structural 
significance.  Many factors affect the analysis of conserved regions within 
related sequences, such as the number of sequences included in the analysis, 
and the ratio of the number of very similar (almost identical) sequences to the 
number of more distantly related sequences.  Divergent sequences can cause 
problems in a multiple sequence alignment. It is more difficult to identify 
the correct alignment when two sequences that are related throughout part of 
the sequence also contain large sections that diverge.  Therefore, the error 
rates in the alignment increase as divergence increases.  These errors in the 
alignment can cause the related part of the sequences to show lower similarity 
than they actually have, and this sort of error is often amplified in 
subsequent steps. 
<cite xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" src="#clustalw">ClustalW</cite> (1),
a commonly used multiple sequence alignment program, addresses the problems 
associated with alignment of divergent sequences in several ways.  Individual 
weights are assigned to each sequence in a partial alignment such that 
near-duplicate sequences are down-weighted and   divergent sequences are 
up-weighted. Also, the amino acid substitution matrices at different alignment 
stages are chosen according to the divergence of the sequences to be aligned. 
Residue-specific gap penalties and locally reduced gap penalties in hydrophilic 
regions increase the penalty for opening new gaps in regions of regular 
secondary structure.  Therefore, it increases the likelihood that gaps will 
occur in loop regions than in highly structured regions such as alpha helices 
and beta sheets.  Highly structured regions are commonly very important to the 
fold and function of a protein, and so divergence is often biologically less 
likely in these areas.  For similar reasons, existing gaps receive locally 
reduced gap penalties to encourage the opening up of new gaps near the existing 
ones. These features have been designed into ClustalW to produce multiple 
sequence alignments that are biologically meaningful.
    </para>
		<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="para2">First, use the example of analyzing the variance in troponin I isoforms in 
Homo sapiens to get acquainted with multiple sequence alignments with ClustalW. 
 <link xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" src="http://www.ebi.ac.uk/clustalw/">ClustalW</link> is available at 
many bioinformatics web sites, but the EBI site is chosen here, for its nice 
interface and graphical display.  Accept the default values on the submission 
form, and  
scroll down the page until  the box for pasting in the sequences to be aligned 
appears.  Now, the troponin I sequences must be obtained.  For the sake of time, instead of searching with the string "troponin I human", 
the pertinent accession codes are supplied for this exercise.  Open a new browser 
window to the  <link xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" src="http://www.ncbi.nlm.nih.gov/">NCBI home page</link>.  
Locate the "Search" box at the top of the page and select 
"Protein" to search the protein database.    
Type in the accession code 
TNNI3_HUMAN in the box to the right, and click on "Go". The results of this search will 
become part of the search history.  Select the history link from the menu
under the query box to verify this.  Now, search "Protein" again, using the
accession code TNNI2_HUMAN, then perform one last search using the accession code 
TNNI1_HUMAN.  As an illustration of the search history function in Entrez, combine the
results of these three searches.  Do this using the boolean operator "OR" in 
between the number assigned to each search in the history listing.  For instance,
if the Search History gave the following list,
<code xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" type="block">
#3 Search TNNI1_HUMAN 	17:44:55 	
#2 Search TNNI2_HUMAN 	17:44:49 	
#1 Search TNNI3_HUMAN 	17:41:47 	</code>
then "#1 OR #2 OR #3" would be the search string.    
The boolean operator
OR is specifying that all results included in any of the above searches be combined.
Using the boolean AND operator would specify only results that are common to 
all three searches, which in this case would yield zero results.  To view the results, click 
on "GO" once you have entered the search string into the query box.
Now, the combined search should return all three of the desired troponin I isoforms.
Check the box to the left of each accession code for all three results.   
Just above the list of results, find the region on the left that states 
"Display Summary" and change "Summary" to "FASTA".  This should yield the amino acid sequences in FASTA format for the 
3 proteins that were selected.  Copy and paste each sequence into the ClustalW 
window, pressing return after pasting each entry.  There does not have to be a 
line space between entries, as long as the FASTA identifying line starts on a 
new line.  However, it does not hurt to have a line space between entries, 
either.  Note that the numbered search description line from Entrez
is not part of the FASTA format.  The numbered search description line will look 
something like this,
<code xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" type="block">
1:  P19237. Reports  Troponin I, slow ...[gi:1351298]
</code>
and should be omitted from the ClustalW search query.  Also, check that the 
description header for the sequence
in FASTA format does not take up more than one line.  If it does, shorten the 
description so that it only occupies one line.
 Press the "Run" button, and click on the link for the browser window 
that displays the results, if this option is given.  A text page will appear 
with the alignment scores.
    </para>
		<exercise xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="ex1">
			<problem xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">
				<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="prob1">
 	  What is the score for the alignment of TNNI3 to TNNI2?
 	  </para>
			</problem>
		</exercise>
		<exercise xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="ex2">
			<problem xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">
				<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="prob2">
 	  What is the score for the alignment of TNNI3 to TNNI1?
 	  </para>
			</problem>
		</exercise>
		<exercise xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="ex3">
			<problem xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">
				<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="prob3">
 	  What is the score for the alignment of TNNI2 to TNNI1?
 	  </para>
			</problem>
		</exercise>
		<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="para3">At the top of the page, a table contains several choices.  
There a link to the home page for the alignment editor Jalview,there is a button, labeled "Start Jalview", 
which is a link to the multiple sequence alignment results in the graphical 
format produced by the Jalview editor.  Choose the "Start Jalview" button  
to view the alignment results.  The sequences are labeled at the left and a bar 
graph below the sequences indicates which regions have high conservation or similarity.  The cardiac isoform of troponin 
I is roughly 30 amino acids longer than the other two isoforms. 
</para>
		<exercise xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="ex4">
			<problem xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">
				<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="prob4">
 	  Looking at the aligned sequences, 
      in what region are the extra amino acids located in cardiac troponin I?
 	  </para>
			</problem>
		</exercise>
		<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="para3a">
Take a look at the color scheme of the alignment.  Regions of the sequence with 
identical amino acids are colored the same, but notice that regions of the 
sequence with similar amino acids have also been colored alike.  
Usually these color schemes have groups consisting of hydrophobic amino acids, 
hydrophilic amino acids, positively-charged amino acids, and negatively-charged 
amino acids.  Sometimes these large color groups are divided further to 
distinguish between sidechain lengths, the aromatic sidechains, glycines 
and prolines.  
    </para>
		<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="para4a">
Try one more multiple sequence alignment, analyzing CFTR sequences from several 
different species.  Return to the <link xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" src="http://www.ebi.ac.uk/clustalw/">
ClustalW</link> submission page.  Cut and paste the CFTR sequences listed below 
from three species into the query submission box and run the multiple alignment.
   </para>
		<code xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" type="block">
&gt;gi|203423|gb|AAA40918.1| cftr [Rattus norvegicus]
IKHSGRVSFSSQISWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQEDITKFAEQDNTVLGEGGVTLSGG
QRARISLARAVYKDADLYLLDSPFGYLDVLTEEQIFESCVCKLMASKTRILVTSKMEQLKKADKILILHE
GSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFSVDDASTTWNKAKQSFRQTGEF
GEKRKNSILSSFSSVKKISIVQKTPLSIEGESDDLQERRLSLVPDSEHGEAALPRSNMITAGPTFPGRRR
QSVLDLMTFTPSSVSSSLQRTRASIRKISLAPRISLKEEDIYSRRLSQDSTLNITEEINEEDLKECFFDD
MVKIPTVTTWNTYLRYFTLHRGLFAVLIWCVLVFLVEVAASLFVLWLLKNNPVNGGNNGTKIANTSYVVV
ITSSSFYYIFYIYVGVADTLLALSLFRGLPLVHTLITASKILHRKMLHSILHAPMSTFNKLKAGGILNRF
SKDIAILDDFLPLTILT
&gt;gi|192832|gb|AAA18903.1| cftr[Mus musculus]
MQKSPLEKASFISKLFFSWTTPILRKGYRHHLELSDIYQAPSADSADHLSEKLEREWDREQASKKNPQLI
HALRRCFFWRFLFYGILLYLGEVTKAVQPVLLGRIIASYDPENKVERSIAIYLGIGLCLLFIVRTLLLHP
AIFGLHRIGMQMRTAMFSLIYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFIWIAPLQVTL
LMGLLWDLLQFSAFCGLGLLIILVIFQAILGKMMVKYRDQRAAKINERLVITSEIIDNIYSVKAYCWESA
MEKMIENLREVELKMTRKAAYMRFFTSSAFFFSGFFVVFLSVLPYTVINGIVLRKIFTTISFCIVLRMSV
TRQFPTAVQIWYDSFGMIRKIQDFLQKQEYKVLEYNLMTTGIIMENVTAFWEEGFGELLEKVQQSNGDRK
HSSDENNVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSF
CSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
AVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTF
SELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFSVDDSSAPWSKPKQSFRQTGEVGEKRKNSIL
NSFSSVRKISIVQKTPLCIDGESDDLQEKRLSLVPDSEQGEAALPRSNMIATGPTFPGRRRQSVLDLMTF
TPNSGSSNLQRTRTSIRKISLVPQISLNEVDVYSRRLSQDSTLNITEEINEEDLKECFLDDVIKIPPVTT
WNTYLRYFTLHKGLLLVLIWCVLVFLVEVAASLFVLWLLKNNPVNSGNNGTKISNSSYVVIITSTSFYYI
FYIYVGVADTLLALSLFRGLPLVHTLITASKILHRKMLHSILHAPMSTISKLKAGGILNRFSKDIAILDD
FLPLTIFDFIQLVFIVIGAIIVVSALQPYIFLATVPGLVVFILLRAYFLHTAQQLKQLESEGRSPIFTHL
VTSLKGLWTLRAFRRQTYFETLFHKALNLHTANWFMYLATLRWFQMRIDMIFVLFFIVVTFISILTTGEG
EGTAGIILTLAMNIMSTLQWAVNSSIDTDSLMRSVSRVFKFIDIQTEESMYTQIIKELPREGSSDVLVIK
NEHVKKSDIWPSGGEMVVKDLTVKYMDDGNAVLENISFSISPGQRVGLLGRTGSGKSTLLSAFLRMLNIK
GDIEIDGVSWNSVTLQEWRKAFGVITQKVFIFSGTFRQNLDPNGKWKDEEIWKVADEVGLKSVIEQFPGQ
LNFTLVDGGYVLSHGHKQLMCLARSVLSKAKIILLDEPSAHLDPITYQVIRRVLKQAFAGCTVILCEHRI
EAMLDCQRFLVIEESNVWQYDSLQALLSEKSIFQQAISSSEKMRFFQGRHSSKHKPRTQITALKEETEEE
VQETRL
&gt;gi|6862589|gb|AAF30300.1|AAF30300 cftr [Mus musculus]
MQKSPLEKASFISKLFFSWSTAILRKGYRQHLELSDIYQAPSADSADHLSEKLEREWDREQASKKNPQLI
HALRRCFFWRFLFYGILLYLGEVTKAVQPVLLGRIIASYDPENKVERSIAIYLGIGLCLLFIVRTLLLHP
AIFGLHRIGMQMRTAMFSLIYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFIWIAPLQVTL
LMGLLWDLLQFSAFCGLGLLIILVIFQAILGKMMVKYRDQRAAKINERLVITSEIIDNIYSVKAYCWESA
MEKMIENLREVELKMTRKAAYMRFFTSSAFFFSGFFVVFLSVLPYTVINGIVLRKIFTTISFCIVLRMSV
TRQFPTAVQIWYDSFGMIRKIQDFLQKQEYKVLEYNLMTTGIIMENVTAFWEEGFGELLEKVQQSNGDRK
HSSDENNVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSF
CSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
AVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTF
SELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFSVDDSSAPWSKPKQSFRQTGEVGEKRKNSIL
NSFSSVRKISIVQKTPLCIDGESDDLQEKRLSLVPDSEQGEAALPRSNMIATGPTFPGRRRQSVLDLMTF
TPNSGSSNLQRTRTSIRKISLVPQISLNEVDVYSRRLSQDSTLNITEEINEEDLKECFLDDVIKIPPVTT
WNTYLRYFTLHKGLLLVLIWCVLVFLVEVAASLFVLWLLKNNPVNSGNNGTKISNSSYVVIITSTSFYYI
FYIYVGVADTLLALSLFRGLPLVHTLITASKILHRKMLHSILHAPMSTISKLKAGGILNRFSKDIAILDD
FLPLTIFDFIQLVFIVIGAIIVVSALQPYIFLATVPGLVVFILLRAYFLHTAQQLKQLESEGRSPIFTHL
VTSLKGLWTLRAFRRQTYFETLFHKALNLHTANWFMYLATLRWFQMRIDMIFVLFFIVVTFISILTTGEG
EGTAGIILTLAMNIMSTLQWAVNSSIDTDSLMRSVSRVFKFIDIQTEESMYTQIIKELPREGSSDVLVIK
NEHVKKSDIWPSGGEMVVKDLTVKYMDDGNAVLENISFSISPGQRVGLLGRTGSGKSTLLSAFLRMLNIK
GDIEIDGVSWNSVTLQEWRKAFGVITQKVFIFSGTFRQNLDPNGKWKDEEIWKVADEVGLKSVIEQFPGQ
LNFTLVDGGYVLSHGHKQLMCLARSVLSKAKIILLDEPSAHLDPITYQVIRRVLKQAFAGCTVILCEHRI
EAMLDCQRFLVIEESNVWQYDSLQALLSEKSIFQQAISSSEKMRFFQGRHSSKHKPRTQITALKEETEEE
VQETRL
&gt;gi|1669377|gb|AAB46340.1| cftr [Homo sapiens]
LLLIVIGAIAVVAVLQPYIFVATVPVIVAFIMLRAYFLQTSQQLKQLESEGRSPIFTHLVTSLKGLWTLR
AFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRIEMIFVIFFIAVTFISILTTGEGEGRVGIILTLA
MNIMSTLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEGKPTKSTKPYKNGQLSKVMIIENSHVKKDDIWPS
GGQMTVKDLTAKYTEGGNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRLLNTEGEIQIDGVSWDS
ITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGGCVL
SHGHKQLMCLARSVLSKAKILLLDEPSAHLDPVTYQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLVI
EENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRL
&gt;gi|180332|gb|AAA35680.1| cftr [Homo sapiens]
MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRELASKKNPKLI
NALRRCFFWRFMFYGIFLYLGEVTKAVQPLLLGRIIASYDPDNKEERSIAIYLGIGLCLLFIVRTLLLHP
AIFGLHHIGMQMRIAMFSLIYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVAL
LMGLIWELLQASAFCGLGFLIVLALFQAGLGRMMMKYRDQRAGKISERLVITSEMIENIQSVKAYCWEEA
MEKMIENLRQTELKLTRKAAYVRYFNSSAFFFSGFFVVFLSVLPYALIKGIILRKIFTTISFCIVLRMAV
TRQFPWAVQTWYDSLGAINKIQDFLQKQEYKTLEYNLTTTEVVMENVTAFWEEGFGELFEKAKQNNNNRK
TSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISF
CSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLAR
AVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILNEGSSYFYGTF
SELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETLHRFSLEGDAPVSWTETKKQSFKQTGEFGEKRKNS
ILNPINSIRKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVL
NLMTHSVNQGQNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDLKECLFDDMESI
PAVTTWNTYLRYITVHKSLIFVLIWCLVIFLAEVAASLVVLWLLGNTPLQDKGNSTHSRNNSYAVIITST
SSYYVFYIYVGVADTLLAMGFFRGLPLVHTLITVSKILHHKMLHSVLQAPMSTLNTLKAGGILNRFSKDI
AILDDLLPLTIFDFIQLLLIVIGAIAVVAVLQPYIFVATVPVIVAFIMLRAYFLQTSQQLKQLESEGRSP
IFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRIEMIFVIFFIAVTFISIL
TTGEGEGRVGIILTLAMNIMSTLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEGKPTKSTKPYKNGQLSKV
MIIENSHVKKDDIWPSGGQMTVKDLTAKYTEGGNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRL
LNTEGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGLRSVIEQ
FPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPVTYQIIRRTLKQAFADCTVILC
EHRIEAMLECQQFLVIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEE
TEEEVQDTRL
&gt;gi|1809238|gb|AAB46352.1| cftr [Homo sapiens]
MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRELASKKNPKLI
NALRRCFFWRFMFYGIFLYLGEVTKAVQPLLLGRIIASYDPDNKEERSIAIYLGIGLCLLFIVRTLLLHP
AIFGLHHIGMQMRIAMFSLIYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVAL
LMGLIWELLQASAFCGLGFLIVLALFQAGLGRMMMKYRDQRAGKISERLVITSEMIENIQSVKAYCWEEA
MEKMIENLRQTELKLTRKAAYVRYFNSSAFFFSGFFVVFLSVLPYALIKGIILRKIFTTISFCIVLRMAV
TRQFPWAVQTWYDSLGAINKIQDFLQKQEYKTLEYNLTTTEVVMENVTAFWEEGFGELFEKAKQNNNNRK
TSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEGKIKHSGRISF
CSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLAR
AVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTF
SELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETLHRFSLEGDAPVSWTETKKQSFKQTGEFGEKRKNS
ILNPINSIRKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVL
NLMTHSVNQGQNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDLKECFFDDMESI
PAVTTWNTYLRYITVHKSLIFVLIWCLVIFLAEVAASLVVLWLLGNTPLQDKGNSTHSRNNSYAVIITST
SSYYVFYIYVGVADTLLAMGFFRGLPLVHTLITVSKILHHKMLHSVLQAPMSTLNTLKAGGILNRFSKDI
AILDDLLPLTIFDFIQ
	</code>
		<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="para4b">
Before looking at the alignment in Jalview, look at the text results. 
    </para>
		<exercise xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="ex5">
			<problem xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">
				<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="prob5">
 	  Which 2 sequences align with the highest pairwise 
      alignment score?
 	  </para>
			</problem>
		</exercise>
		<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="para4c">Look at the text display of the alignments, shown just below the scores.  
Try to determine the regions where the 6 sequences align most closely.  
Many people find this type of text display hard to interpret (a fact that is 
good to remember when putting together a figure for a presentation or an 
article).  At the bottom of the text display is a cladogram.  A cladogram is 
a branched phylogenetic-type tree where the branches are of equal length.  
Cladograms can show common ancestry, but because the branches have equal 
lengths, they do not provide an accurate indication of the evolutionary 
distance between the branches.
    </para>
		<exercise xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="ex6">
			<problem xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">
				<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="prob6">
 	  Does the cladogram group together all 
      the human CFTR sequences in the same branch? 
 	  </para>
			</problem>
		</exercise>
		<exercise xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="ex7">
			<problem xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">
				<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="prob7">
 	  Now, look at the alignment in Jal view.  
  Is it easier to identify the regions where all 
      6 sequences align most closely in the Jalview display?
 	  </para>
			</problem>
		</exercise>
		<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="para4d">Leave both of these windows open 
(closing the ClustalW text results browser page may cause the Jalview editor page 
to disappear automatically).  Notice the file number assigned this  
Jalview sequence alignment.  This is to help distinguish it for purposes of comparison from the next 
and last alignment in this tutorial, where the gap penalty will be manipulated 
from the default values.  
</para>
		<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="para5a">Finally, repeat the CFTR alignment using the sequences above, but this time 
change "Gap Open" to 100.  
(Click on the term "Gap Open" to view the default value.)  This will increase 
the penalty for opening a gap.  For more information on gaps and gap penalties, 
view the EBI help page entitled 
<link xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" src="http://www.ebi.ac.uk/help/gaps_frame.html">"About Gaps"</link>.  
Compare the group alignment scores from the previous alignment with these group 
alignment scores.  The group alignment scores can be found in the .output file (listed in the results section) 
under the section which starts:
</para><code xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" type="block">
	Start of Multiple Alignment
	There are 5 groups
	Aligning...
	</code>
		<exercise xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="ex8">
			<problem xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">
				<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="prob8">
 	 Does changing the gap open penalty affect the group 
      alignment scores?
 	  </para>
			</problem>
		</exercise>
		<exercise xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="ex9">
			<problem xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">
				<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="prob9">
 	 Are the group scores higher or lower when the penalty 
      is increased to 100?
 	  </para>
			</problem>
		</exercise>
		<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="para5b">
 View the Jalview display of the new alignment.  
Compare the Jalview displays of the first alignment, 
and the new alignment with the increased gap penalty, 
in the regions numbered 1220 to 1250.
    </para>
		<exercise xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="ex10">
			<problem xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/">
				<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="prob10">
 	 Describe the differences in the two alignments in 
this region, both in terms of the gaps, and in terms of the similarity bar 
graph displayed below the sequences.
 	  </para>
			</problem>
		</exercise>
		<para xmlns:md="http://cnx.rice.edu/mdml/0.4" xmlns:m="http://www.w3.org/1998/Math/MathML" xmlns:bib="http://bibtexml.sf.net/" id="conclusion">
A look at the ClustalW submission page is enough to see that there are many  more parameters that can be manipulated by the user.  However, the default values have been optimized and generally should be left alone, except in cases where the user has a definitive justification for making the change.   It does frequently occur in biology, though, that the user knows some empirical information that conflicts with the results given by an alignment performed with the default values.  In these cases, a scientific argument can be made for altering the parameters to force the alignment to reflect the empirical information.
    </para>
	</content>
	<bib:file>
		<bib:entry id="clustalw">
			<bib:article>
				<bib:author>Thompson J.D., Higgins D.G., Gibson T.J.</bib:author>
				<bib:title>CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice</bib:title>
				<bib:journal>Nucleic Acids Res.</bib:journal>
				<bib:year>1994</bib:year>
				<bib:pages>22:4673-4680</bib:pages>
			</bib:article>
		</bib:entry>
	</bib:file>
</document>
